Web stats for Terrijohnsoncreates - terrijohnsoncreates.com
Sharing Tips and Tutorials for my Sewing, Embroidery and Silhouette Cameo creations
1.83 Rating by ClearWebStats
terrijohnsoncreates.com is 1 decade 1 year 8 months old. This website has a #1,178,221 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 720.00 and has a daily earning of $ 3.00. While no active threats were reported recently by users, terrijohnsoncreates.com is SAFE to browse.
Traffic Report of Terrijohnsoncreates
Daily Unique Visitors: | 408 |
Daily Pageviews: | 816 |
Estimated Valuation
Income Per Day: | $ 3.00 |
Estimated Worth: | $ 720.00 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank
PR 1 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is terrijohnsoncreates.com server located?
Social Engagement
Facebook Shares: | 163 |
Facebook Likes: | 85 |
Facebook Comments: | 41 |
Twitter Count (Tweets): | 10 |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 10 |
H3 Headings: | Not Applicable | H4 Headings: | 6 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 34 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 69.89.31.231)
CEC Artslink
- cecartslink.org
CEC ArtsLink is an international arts organization, whose programs encourage and support exchange among visual and performing artists and cultural managers in the United States and in Central and Eastern Europe, Russia and Central Asia and the Caucasus.
Mediterranean Center of Social and Educational Research
- mcser.org
MCSER is an interuniversity center delivering supports and services to education and research in Italy and the world. Mediterranean Journal of Social Sciences is a publication of MCSER.
Knowledge Economy® — Knowledge … It's Accepted Everywhere
- knowledgeeconomy.com
Knowledge … It’s Accepted Everywhere
Downtown Denton Main Street | The pace is different here.
- downtowndenton.com
HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 23:26:48 GMT
Server: Apache
X-Pingback: http://terrijohnsoncreates.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 13990
Content-Type: text/html; charset=UTF-8
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 23:26:48 GMT
Server: Apache
X-Pingback: http://terrijohnsoncreates.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 13990
Content-Type: text/html; charset=UTF-8
Domain Information for terrijohnsoncreates.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
terrijohnsoncreates.com | A | 400 |
IP:69.89.31.231 |
terrijohnsoncreates.com | NS | 21599 |
Target:ns2.bluehost.com |
terrijohnsoncreates.com | NS | 21599 |
Target:ns1.bluehost.com |
terrijohnsoncreates.com | SOA | 21599 |
MNAME:ns1.bluehost.com RNAME:dnsadmin.box431.bluehost.com Serial:2015010201 Refresh:86400 Retry:7200 Expire:3600000 |
terrijohnsoncreates.com | MX | 14399 |
Target:mail.terrijohnsoncreates.com |
terrijohnsoncreates.com | TXT | 14399 |
TXT:v=spf1 a mx ptr include:bluehost.com ?all |
Similarly Ranked Websites to Terrijohnsoncreates
.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
IlTuopsicologo - Psicologia, Psicologo e Psicoterapeuta online
- iltuopsicologo.it
Sito di psicologia, dai contenuti innovativi, con utili indicazioni sui vari disagi psichici e relative terapie ed autoterapie. Consulenze online gratuite. Presenti diverse sezioni tematiche.